Lineage for d6f76f1 (6f76 F:1-168)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868522Domain d6f76f1: 6f76 F:1-168 [415912]
    Other proteins in same PDB: d6f76a2, d6f76b2, d6f76c2, d6f76d2, d6f76e2, d6f76f2
    automated match to d5us4a_
    complexed with cvk, gnp, mg

Details for d6f76f1

PDB Entry: 6f76 (more details), 2.2 Å

PDB Description: antibody derived (abd-8) small molecule binding to kras.
PDB Compounds: (F:) GTPase KRas

SCOPe Domain Sequences for d6f76f1:

Sequence, based on SEQRES records: (download)

>d6f76f1 c.37.1.8 (F:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Sequence, based on observed residues (ATOM records): (download)

>d6f76f1 c.37.1.8 (F:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
hamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrt
vdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

SCOPe Domain Coordinates for d6f76f1:

Click to download the PDB-style file with coordinates for d6f76f1.
(The format of our PDB-style files is described here.)

Timeline for d6f76f1:

  • d6f76f1 is new in SCOPe 2.08-stable