SCOPe 2.08: Domain d6f76d1: 6f76 D:1-167

Lineage for d6f76d1 (6f76 D:1-167)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6f76d1: 6f76 D:1-167 [415908]
   Other proteins in same PDB: d6f76a2, d6f76b2, d6f76c2, d6f76d2, d6f76e2, d6f76f2
   automated match to d5us4a_
   complexed with cvk, gnp, mg

Details for d6f76d1

PDB Entry: 6f76, 2.2 Å

PDB Description: antibody derived (abd-8) small molecule binding to kras.

PDB Compounds: (D:) GTPase KRas

SCOPe Domain Sequences for d6f76d1:

Sequence, based on SEQRES records:

>d6f76d1 c.37.1.8 (D:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records):

>d6f76d1 c.37.1.8 (D:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
hrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvd
tkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Timeline for d6f76d1:

• d6f76d1 is new in SCOPe 2.08-stable