Lineage for d1a48a_ (1a48 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585933Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2585934Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 2585935Family d.143.1.1: SAICAR synthase [56105] (1 protein)
    automatically mapped to Pfam PF01259
  6. 2585936Protein SAICAR synthase [56106] (2 species)
  7. 2585937Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56107] (6 PDB entries)
  8. 2585941Domain d1a48a_: 1a48 A: [41590]
    complexed with so4

Details for d1a48a_

PDB Entry: 1a48 (more details), 1.9 Å

PDB Description: saicar synthase
PDB Compounds: (A:) phosphoribosylaminoimidazole-succinocarboxamide synthase

SCOPe Domain Sequences for d1a48a_:

Sequence, based on SEQRES records: (download)

>d1a48a_ d.143.1.1 (A:) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
skwsh

Sequence, based on observed residues (ATOM records): (download)

>d1a48a_ d.143.1.1 (A:) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstdenispaqaaelvgedls
rrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfwngas
ykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskwsh

SCOPe Domain Coordinates for d1a48a_:

Click to download the PDB-style file with coordinates for d1a48a_.
(The format of our PDB-style files is described here.)

Timeline for d1a48a_: