Lineage for d1a48__ (1a48 -)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511931Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 511932Superfamily d.143.1: SAICAR synthase-like [56104] (3 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 511933Family d.143.1.1: SAICAR synthase [56105] (1 protein)
  6. 511934Protein SAICAR synthase [56106] (2 species)
  7. 511935Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56107] (3 PDB entries)
  8. 511937Domain d1a48__: 1a48 - [41590]

Details for d1a48__

PDB Entry: 1a48 (more details), 1.9 Å

PDB Description: saicar synthase

SCOP Domain Sequences for d1a48__:

Sequence, based on SEQRES records: (download)

>d1a48__ d.143.1.1 (-) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae)}
sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
skwsh

Sequence, based on observed residues (ATOM records): (download)

>d1a48__ d.143.1.1 (-) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae)}
sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstdenispaqaaelvgedls
rrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfwngas
ykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskwsh

SCOP Domain Coordinates for d1a48__:

Click to download the PDB-style file with coordinates for d1a48__.
(The format of our PDB-style files is described here.)

Timeline for d1a48__: