Lineage for d6er8a1 (6er8 A:8-207)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738537Fold a.265: Fic-like [140930] (1 superfamily)
    multihelical; one central helix is surrounded by seven helices
  4. 2738538Superfamily a.265.1: Fic-like [140931] (1 family) (S)
  5. 2738539Family a.265.1.1: Fic-like [140932] (3 proteins)
    Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix
  6. 2738547Protein automated matches [191277] (4 species)
    not a true protein
  7. 2738548Species Enterococcus faecalis [TaxId:1351] [364433] (7 PDB entries)
  8. 2738571Domain d6er8a1: 6er8 A:8-207 [415892]
    Other proteins in same PDB: d6er8a2
    automated match to d6ep5b_
    complexed with act, po4

Details for d6er8a1

PDB Entry: 6er8 (more details), 2.29 Å

PDB Description: enterococcus faecalis fic protein in complex with phosphate.
PDB Compounds: (A:) Fic family protein

SCOPe Domain Sequences for d6er8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6er8a1 a.265.1.1 (A:8-207) automated matches {Enterococcus faecalis [TaxId: 1351]}
mlenklgiinqlelnrveervskenakrlydsgdidrievgtfkglsyihnylfediyef
agkvrsqniskgnfrfapvmyleialehidkmpqrnldeivakyvemniahpfregngra
triwldlilkkelkrvvdwnlinkedylsamerspvkdleikylisnaltdkindreifm
kgidisyyyegyteynvdel

SCOPe Domain Coordinates for d6er8a1:

Click to download the PDB-style file with coordinates for d6er8a1.
(The format of our PDB-style files is described here.)

Timeline for d6er8a1:

  • d6er8a1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6er8a2
View in 3D
Domains from other chains:
(mouse over for more information)
d6er8b_