Lineage for d1cknb2 (1ckn B:11-238)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217840Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2217893Family d.142.2.3: mRNA capping enzyme [56100] (2 proteins)
    automatically mapped to Pfam PF01331
  6. 2217898Protein RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain [56101] (1 species)
  7. 2217899Species Chlorella virus PBCV-1 [TaxId:10506] [56102] (3 PDB entries)
  8. 2217903Domain d1cknb2: 1ckn B:11-238 [41588]
    Other proteins in same PDB: d1ckna1, d1cknb1
    protein/RNA complex; complexed with gtp, mn, so4

Details for d1cknb2

PDB Entry: 1ckn (more details), 2.5 Å

PDB Description: structure of guanylylated mrna capping enzyme complexed with gtp
PDB Compounds: (B:) mRNA capping enzyme

SCOPe Domain Sequences for d1cknb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cknb2 d.142.2.3 (B:11-238) RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]}
nitteravltlnglqiklhkvvgesrddivakmkdlamddhkfprlpgpnpvsierkdfe
klkqnkyvvsektdgirfmmfftrvfgfkvctiidramtvyllpfkniprvlfqgsifdg
elcvdivekkfafvlfdavvvsgvtvsqmdlasrffamkrslkefknvpedpailrykew
iplehptiikdhlkkanaiyhtdgliimsvdepviygrnfnlfklkpg

SCOPe Domain Coordinates for d1cknb2:

Click to download the PDB-style file with coordinates for d1cknb2.
(The format of our PDB-style files is described here.)

Timeline for d1cknb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cknb1