Lineage for d1ckna2 (1ckn A:11-238)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611545Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 611763Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) (S)
    has a circularly permuted topology
  5. 611790Family d.142.2.3: mRNA capping enzyme [56100] (2 proteins)
  6. 611795Protein RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain [56101] (1 species)
  7. 611796Species Chlorella virus, PBCV-1 [56102] (3 PDB entries)
  8. 611799Domain d1ckna2: 1ckn A:11-238 [41587]
    Other proteins in same PDB: d1ckna1, d1cknb1

Details for d1ckna2

PDB Entry: 1ckn (more details), 2.5 Å

PDB Description: structure of guanylylated mrna capping enzyme complexed with gtp

SCOP Domain Sequences for d1ckna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckna2 d.142.2.3 (A:11-238) RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain {Chlorella virus, PBCV-1}
nitteravltlnglqiklhkvvgesrddivakmkdlamddhkfprlpgpnpvsierkdfe
klkqnkyvvsektdgirfmmfftrvfgfkvctiidramtvyllpfkniprvlfqgsifdg
elcvdivekkfafvlfdavvvsgvtvsqmdlasrffamkrslkefknvpedpailrykew
iplehptiikdhlkkanaiyhtdgliimsvdepviygrnfnlfklkpg

SCOP Domain Coordinates for d1ckna2:

Click to download the PDB-style file with coordinates for d1ckna2.
(The format of our PDB-style files is described here.)

Timeline for d1ckna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ckna1