Lineage for d1ckna2 (1ckn A:11-238)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. Family d.142.2.3: mRNA capping enzyme [56100] (2 proteins)
    automatically mapped to Pfam PF01331
  6. Protein RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain [56101] (1 species)
  7. Species Chlorella virus PBCV-1 [TaxId:10506] [56102] (3 PDB entries)
  8. Domain d1ckna2: 1ckn A:11-238 [41587]
    Other proteins in same PDB: d1ckna1, d1cknb1
    protein/RNA complex; complexed with gtp, mn, so4

Details for d1ckna2

PDB Entry: 1ckn (more details), 2.5 Å

PDB Description: structure of guanylylated mrna capping enzyme complexed with gtp
PDB Compounds: (A:) mRNA capping enzyme

SCOPe Domain Sequences for d1ckna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckna2 d.142.2.3 (A:11-238) RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]}
nitteravltlnglqiklhkvvgesrddivakmkdlamddhkfprlpgpnpvsierkdfe
klkqnkyvvsektdgirfmmfftrvfgfkvctiidramtvyllpfkniprvlfqgsifdg
elcvdivekkfafvlfdavvvsgvtvsqmdlasrffamkrslkefknvpedpailrykew
iplehptiikdhlkkanaiyhtdgliimsvdepviygrnfnlfklkpg

SCOPe Domain Coordinates for d1ckna2 are not available.

Timeline for d1ckna2:

Domains from same chain:
(mouse over for more information)
d1ckna1
Domains from other chains:
(mouse over for more information)
d1cknb1, d1cknb2