![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.265: Fic-like [140930] (1 superfamily) multihelical; one central helix is surrounded by seven helices |
![]() | Superfamily a.265.1: Fic-like [140931] (1 family) ![]() |
![]() | Family a.265.1.1: Fic-like [140932] (3 proteins) Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix |
![]() | Protein automated matches [191277] (4 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:1351] [364433] (7 PDB entries) |
![]() | Domain d6ep0a_: 6ep0 A: [415865] Other proteins in same PDB: d6ep0b2 automated match to d6ep5b_ complexed with amp, ca, cl |
PDB Entry: 6ep0 (more details), 2.35 Å
SCOPe Domain Sequences for d6ep0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ep0a_ a.265.1.1 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]} lenklgiinqlelnrveervskenakrlydsgdidrievgtfkglsyihnylfediyefa gkvrsqniskgnfrfapvmyleialehidkmpqrnldeivakyvemniahpfregngrat riwldlilkkelkrvvdwnlinkedylsamerspvkdleikylisnaltdkindreifmk gidisyyyegyteynvdel
Timeline for d6ep0a_: