Class g: Small proteins [56992] (100 folds) |
Fold g.102: Jumonji C-terminal domain-like [418708] (1 superfamily) alpha + beta fold, with C5HC2 zinc finger binding 2 zinc ions |
Superfamily g.102.1: Jumonji C-terminal domain-like [418737] (2 families) |
Family g.102.1.1: Jumonji C-terminal domain [418787] (1 protein) Pfam PF02928 |
Protein KDM5B (JARID1B or PLU1) C-terminal domain [419086] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [419583] (14 PDB entries) |
Domain d6ek6a2: 6ek6 A:623-754 [415863] Other proteins in same PDB: d6ek6a1, d6ek6a3 automated match to d5a1fa2 complexed with 90v, dms, edo, mn, ni, zn |
PDB Entry: 6ek6 (more details), 2.05 Å
SCOPe Domain Sequences for d6ek6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ek6a2 g.102.1.1 (A:623-754) KDM5B (JARID1B or PLU1) C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} rycvfshdemickmaskadvldvvvastvqkdmaimiedekalretvrklgvidsermdf ellpdderqcvkckttcfmsaiscsckpgllvclhhvkelcscppykyklryrytlddly pmmnalklraes
Timeline for d6ek6a2: