Lineage for d6ej1a2 (6ej1 A:623-754)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039154Fold g.102: Jumonji C-terminal domain-like [418708] (1 superfamily)
    alpha + beta fold, with C5HC2 zinc finger binding 2 zinc ions
  4. 3039155Superfamily g.102.1: Jumonji C-terminal domain-like [418737] (2 families) (S)
  5. 3039156Family g.102.1.1: Jumonji C-terminal domain [418787] (1 protein)
    Pfam PF02928
  6. 3039157Protein KDM5B (JARID1B or PLU1) C-terminal domain [419086] (1 species)
  7. 3039158Species Human (Homo sapiens) [TaxId:9606] [419583] (14 PDB entries)
  8. 3039162Domain d6ej1a2: 6ej1 A:623-754 [415857]
    Other proteins in same PDB: d6ej1a1, d6ej1a3
    automated match to d5a1fa2
    complexed with b7q, dms, edo, mn, zn

Details for d6ej1a2

PDB Entry: 6ej1 (more details), 2.07 Å

PDB Description: crystal structure of kdm5b in complex with kdopz48a.
PDB Compounds: (A:) Lysine-specific demethylase 5B,Lysine-specific demethylase 5B

SCOPe Domain Sequences for d6ej1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ej1a2 g.102.1.1 (A:623-754) KDM5B (JARID1B or PLU1) C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rycvfshdemickmaskadvldvvvastvqkdmaimiedekalretvrklgvidsermdf
ellpdderqcvkckttcfmsaiscsckpgllvclhhvkelcscppykyklryrytlddly
pmmnalklraes

SCOPe Domain Coordinates for d6ej1a2:

Click to download the PDB-style file with coordinates for d6ej1a2.
(The format of our PDB-style files is described here.)

Timeline for d6ej1a2:

  • d6ej1a2 is new in SCOPe 2.08-stable