Lineage for d6eiua1 (6eiu A:26-622)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815818Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
    Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811)
  6. 2816275Protein KDM5B (JARID1B or PLU1) core [419085] (1 species)
  7. 2816276Species Human (Homo sapiens) [TaxId:9606] [419582] (14 PDB entries)
  8. 2816277Domain d6eiua1: 6eiu A:26-622 [415844]
    Other proteins in same PDB: d6eiua2, d6eiua3
    automated match to d5a1fa1
    complexed with b6t, dms, edo, mn, zn

Details for d6eiua1

PDB Entry: 6eiu (more details), 1.88 Å

PDB Description: crystal structure of kdm5b in complex with kdopz29a
PDB Compounds: (A:) Lysine-specific demethylase 5B,Lysine-specific demethylase 5B

SCOPe Domain Sequences for d6eiua1:

Sequence, based on SEQRES records: (download)

>d6eiua1 b.82.2.14 (A:26-622) KDM5B (JARID1B or PLU1) core {Human (Homo sapiens) [TaxId: 9606]}
flpppecpvfepsweefadpfafihkirpiaeqtgickvrpppdwqppfacdvdklhftp
riqrlneleaqtrvklggggardytlrtfgemadafksdyfnmpvhmvptelvekefwrl
vstieedvtveygadiaskefgsgfpvrdgkiklspeeeeyldsgwnlnnmpvmeqsvla
hitadicgmklpwlyvgmcfssfcwhiedhwsysinylhwgepktwygvpgyaaeqlenv
mkklapelfvsqpdllhqlvtimnpntlmthevpvyrtnqcagefvitfprayhsgfnqg
fnfaeavnfctvdwlplgrqcvehyrllh

Sequence, based on observed residues (ATOM records): (download)

>d6eiua1 b.82.2.14 (A:26-622) KDM5B (JARID1B or PLU1) core {Human (Homo sapiens) [TaxId: 9606]}
flpppecpvfepsweefadpfafihkirpiaeqtgickvrpppdwqppfacdvdklhftp
riqrlneleaqtrvkardytlrtfgemadafksdyfnmpvhmvptelvekefwrlvstie
edvtveygadiaskefgsgfpvriklspeeeeyldsgwnlnnmpvmeqsvlahitadicg
mklpwlyvgmcfssfcwhiedhwsysinylhwgepktwygvpgyaaeqlenvmkklapel
fvsqpdllhqlvtimnpntlmthevpvyrtnqcagefvitfprayhsgfnqgfnfaeavn
fctvdwlplgrqcvehyrllh

SCOPe Domain Coordinates for d6eiua1:

Click to download the PDB-style file with coordinates for d6eiua1.
(The format of our PDB-style files is described here.)

Timeline for d6eiua1:

  • d6eiua1 is new in SCOPe 2.08-stable