SCOPe 2.08: Domain d6dvra_: 6dvr A:

Lineage for d6dvra_ (6dvr A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins)
   lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain

6. Protein automated matches [254715] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [313441] (18 PDB entries)

8. Domain d6dvra_: 6dvr A: [415799]
   automated match to d2v7ea_
   complexed with hdg, p15, unx

Details for d6dvra_

PDB Entry: 6dvr, 1.54 Å

PDB Description: crystal structure of human carm1 with (r)-ski-72

PDB Compounds: (A:) histone-arginine methyltransferase carm1

SCOPe Domain Sequences for d6dvra_:

Sequence; same for both SEQRES and ATOM records:

>d6dvra_ c.66.1.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcgsgilsffaaqaga
rkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdiiisepmgymlfner
mlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwyqpsfhgvdlsalr
gaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipfkfhmlhsglvhgl
afwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtlsgtclliankrqs
ydisivaqvdqtgskssnlldlknpffrytgttpspp

Timeline for d6dvra_:

• d6dvra_ is new in SCOPe 2.08-stable