SCOP 1.71: Domain d1a0i_2: 1a0i 2-240

Lineage for d1a0i_2 (1a0i 2-240)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families)
   has a circularly permuted topology

5. Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins)

6. Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species)

7. Species Bacteriophage T7 [TaxId:10760] [56094] (1 PDB entry)

8. Domain d1a0i_2: 1a0i 2-240 [41577]
   Other proteins in same PDB: d1a0i_1
   complexed with atp; mutant

Details for d1a0i_2

PDB Entry: 1a0i, 2.6 Å

PDB Description: atp-dependent dna ligase from bacteriophage t7 complex with atp

SCOP Domain Sequences for d1a0i_2:

Sequence, based on SEQRES records:

>d1a0i_2 d.142.2.1 (2-240) ATP-dependent DNA ligase, N-terminal domain {Bacteriophage T7}
vniktnpfkavsfvesaikkaldnagyliaeikydgvrgnicvdntansywlsrvsktip
alehlngfdvrwkrllnddrcfykdgfmldgelmvkgvdfntgsgllrtkwtdtknqefh
eelfvepirkkdkvpfklhtghlhiklyailplhivesgedcdvmtllmqehvknmlpll
qeyfpeiewqaaesyevydmvelqqlyeqkraegheglivkdpmciykrgkksgwwkmk

Sequence, based on observed residues (ATOM records):

>d1a0i_2 d.142.2.1 (2-240) ATP-dependent DNA ligase, N-terminal domain {Bacteriophage T7}
vniktnpfkavsfvesaikkaldnagyliaeikydgvrgnicvdntansywlsrvsktip
alehlngfdvrwkrllnddrcfykdgfmldgelmvkgvdfntgsgllrtkwtdtknqefh
rkkdkvpfklhtghlhiklyailplhivesgedcdvmtllmqehvknmlpllqeyfpeie
wqaaesyevydmvelqqlyeqkraegheglivkdpmciykrgkksgwwkmk

Timeline for d1a0i_2:

• d1a0i_2 first appeared (with stable ids) in SCOP 1.55
  
• d1a0i_2 appears in SCOP 1.69
  
• d1a0i_2 is called d1a0ia2 in SCOP 1.73
  
• d1a0i_2 appears in the current release, SCOPe 2.08, called d1a0ia2