Lineage for d1a0ia2 (1a0i A:2-240)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2979301Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2979302Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins)
    automatically mapped to Pfam PF01068
  6. 2979303Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species)
  7. 2979304Species Bacteriophage T7 [TaxId:10760] [56094] (1 PDB entry)
  8. 2979305Domain d1a0ia2: 1a0i A:2-240 [41577]
    Other proteins in same PDB: d1a0ia1
    protein/DNA complex; complexed with atp

Details for d1a0ia2

PDB Entry: 1a0i (more details), 2.6 Å

PDB Description: atp-dependent dna ligase from bacteriophage t7 complex with atp
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d1a0ia2:

Sequence, based on SEQRES records: (download)

>d1a0ia2 d.142.2.1 (A:2-240) ATP-dependent DNA ligase, N-terminal domain {Bacteriophage T7 [TaxId: 10760]}
vniktnpfkavsfvesaikkaldnagyliaeikydgvrgnicvdntansywlsrvsktip
alehlngfdvrwkrllnddrcfykdgfmldgelmvkgvdfntgsgllrtkwtdtknqefh
eelfvepirkkdkvpfklhtghlhiklyailplhivesgedcdvmtllmqehvknmlpll
qeyfpeiewqaaesyevydmvelqqlyeqkraegheglivkdpmciykrgkksgwwkmk

Sequence, based on observed residues (ATOM records): (download)

>d1a0ia2 d.142.2.1 (A:2-240) ATP-dependent DNA ligase, N-terminal domain {Bacteriophage T7 [TaxId: 10760]}
vniktnpfkavsfvesaikkaldnagyliaeikydgvrgnicvdntansywlsrvsktip
alehlngfdvrwkrllnddrcfykdgfmldgelmvkgvdfntgsgllrtkwtdtknqefh
rkkdkvpfklhtghlhiklyailplhivesgedcdvmtllmqehvknmlpllqeyfpeie
wqaaesyevydmvelqqlyeqkraegheglivkdpmciykrgkksgwwkmk

SCOPe Domain Coordinates for d1a0ia2:

Click to download the PDB-style file with coordinates for d1a0ia2.
(The format of our PDB-style files is described here.)

Timeline for d1a0ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0ia1