Lineage for d2dika3 (2dik A:2-376)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217544Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (2 proteins)
    automatically mapped to Pfam PF01326
  6. 2217545Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (3 species)
    the common fold is interrupted by a 4-helical subdomain (residues 112-198)
  7. 2217546Species Clostridium symbiosum [TaxId:1512] [56087] (7 PDB entries)
  8. 2217551Domain d2dika3: 2dik A:2-376 [41574]
    Other proteins in same PDB: d2dika1, d2dika2
    complexed with so4; mutant

Details for d2dika3

PDB Entry: 2dik (more details), 2.5 Å

PDB Description: r337a mutant of pyruvate phosphate dikinase
PDB Compounds: (A:) protein (pyruvate phosphate dikinase)

SCOPe Domain Sequences for d2dika3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dika3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum [TaxId: 1512]}
akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
qdqifeaitwleelngkkfgdtedpllvsvrsaarasmpgmmdtilnlglndvavegfak
ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
ykqfmdlamklekhfrdmqdmeftieegklyflqtangkrtapaalqiacdlvdegmite
eeavvrieaksldql

SCOPe Domain Coordinates for d2dika3:

Click to download the PDB-style file with coordinates for d2dika3.
(The format of our PDB-style files is described here.)

Timeline for d2dika3: