Lineage for d2dika3 (2dik A:2-376)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262579Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 262580Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 262734Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (1 protein)
  6. 262735Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (2 species)
    the common fold is interrupted by a 4-helical subdomain (residues 112-198)
  7. 262736Species Clostridium symbiosum [TaxId:1512] [56087] (6 PDB entries)
  8. 262741Domain d2dika3: 2dik A:2-376 [41574]
    Other proteins in same PDB: d2dika1, d2dika2
    complexed with so4; mutant

Details for d2dika3

PDB Entry: 2dik (more details), 2.5 Å

PDB Description: r337a mutant of pyruvate phosphate dikinase

SCOP Domain Sequences for d2dika3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dika3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum}
akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
qdqifeaitwleelngkkfgdtedpllvsvrsaarasmpgmmdtilnlglndvavegfak
ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
ykqfmdlamklekhfrdmqdmeftieegklyflqtangkrtapaalqiacdlvdegmite
eeavvrieaksldql

SCOP Domain Coordinates for d2dika3:

Click to download the PDB-style file with coordinates for d2dika3.
(The format of our PDB-style files is described here.)

Timeline for d2dika3: