Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (1 protein) automatically mapped to Pfam PF01326 |
Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (3 species) the common fold is interrupted by a 4-helical subdomain (residues 112-198) |
Species Clostridium symbiosum [TaxId:1512] [56087] (7 PDB entries) |
Domain d1ggoa3: 1ggo A:2-376 [41573] Other proteins in same PDB: d1ggoa1, d1ggoa2 complexed with so4; mutant |
PDB Entry: 1ggo (more details), 2.6 Å
SCOPe Domain Sequences for d1ggoa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggoa3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum [TaxId: 1512]} akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite eeavvrieaksldql
Timeline for d1ggoa3: