Lineage for d1eudb2 (1eud B:0-245)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671104Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1671105Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1671336Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 1671337Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 1671363Species Pig (Sus scrofa) [TaxId:9823] [56084] (6 PDB entries)
    GTP-specific enzyme
  8. 1671364Domain d1eudb2: 1eud B:0-245 [41571]
    Other proteins in same PDB: d1euda1, d1euda2, d1eudb1
    complexed with so4

Details for d1eudb2

PDB Entry: 1eud (more details), 2.1 Å

PDB Description: crystal structure of phosphorylated pig heart, gtp-specific succinyl- coa synthetase
PDB Compounds: (B:) succinyl-coa synthetase, beta chain

SCOPe Domain Sequences for d1eudb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eudb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mvnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvf
ssglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylai
lmdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgp
lqnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifam
ddksen

SCOPe Domain Coordinates for d1eudb2:

Click to download the PDB-style file with coordinates for d1eudb2.
(The format of our PDB-style files is described here.)

Timeline for d1eudb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eudb1