Lineage for d1eudb2 (1eud B:0-245)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196989Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 196990Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 197126Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
  6. 197127Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 197141Species Pig (Sus scrofa) [TaxId:9823] [56084] (2 PDB entries)
  8. 197143Domain d1eudb2: 1eud B:0-245 [41571]
    Other proteins in same PDB: d1euda1, d1euda2, d1eudb1

Details for d1eudb2

PDB Entry: 1eud (more details), 2.1 Å

PDB Description: crystal structure of phosphorylated pig heart, gtp-specific succinyl- coa synthetase

SCOP Domain Sequences for d1eudb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eudb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa)}
mvnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvf
ssglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylai
lmdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgp
lqnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifam
ddksen

SCOP Domain Coordinates for d1eudb2:

Click to download the PDB-style file with coordinates for d1eudb2.
(The format of our PDB-style files is described here.)

Timeline for d1eudb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eudb1