SCOPe 2.08: Domain d6bo6a2: 6bo6 A:287-608

Lineage for d6bo6a2 (6bo6 A:287-608)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Eubacterium eligens [TaxId:515620] [420003] (3 PDB entries)

8. Domain d6bo6a2: 6bo6 A:287-608 [415705]
   Other proteins in same PDB: d6bo6a1
   automated match to d6u7ia3
   complexed with e0v

Details for d6bo6a2

PDB Entry: 6bo6, 2.8 Å

PDB Description: eubacterium eligens beta-glucuronidase bound to unc4917 glucuronic acid conjugate

PDB Compounds: (A:) Glycoside Hydrolase Family 2 candidate b-glucuronidase

SCOPe Domain Sequences for d6bo6a2:

Sequence; same for both SEQRES and ATOM records:

>d6bo6a2 c.1.8.0 (A:287-608) automated matches {Eubacterium eligens [TaxId: 515620]}
vrvdgtkflinekpfyfkgygkhedtfpngrginlpmntkdisimkwqhansfrtshypy
seemmrlcdeegivvidettavgvnlqfggganfggerigtfdkehgvqtqehhkdvird
lisrdknhacvvmwsianepdsaaegaydyfkplydlareldpqkrpctlvsvqgttadt
dcssqlsdviclnryygwyfggpdlevseiglrkelsdwgklgkpvmfteygadtvsglh
dttsvmyteeyqveyyemnnkvfdefdfvvgeqawnfadfatsqsllrvqgnkkglftrd
rkpkmvahyfrnrwstipefgy

Timeline for d6bo6a2:

• d6bo6a2 is new in SCOPe 2.08-stable