Lineage for d1eucb2 (1euc B:0-245)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873884Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 873885Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 874071Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
  6. 874072Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 874098Species Pig (Sus scrofa) [TaxId:9823] [56084] (6 PDB entries)
    GTP-specific enzyme
  8. 874099Domain d1eucb2: 1euc B:0-245 [41570]
    Other proteins in same PDB: d1euca1, d1euca2, d1eucb1
    complexed with po4, so4, zn; mutant

Details for d1eucb2

PDB Entry: 1euc (more details), 2.1 Å

PDB Description: crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase
PDB Compounds: (B:) succinyl-coa synthetase, beta chain

SCOP Domain Sequences for d1eucb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mvnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvf
ssglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylai
lmdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgp
lqnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifam
ddksen

SCOP Domain Coordinates for d1eucb2:

Click to download the PDB-style file with coordinates for d1eucb2.
(The format of our PDB-style files is described here.)

Timeline for d1eucb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eucb1