Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Eubacterium eligens [TaxId:515620] [420003] (3 PDB entries) |
Domain d6bjqa3: 6bjq A:287-610 [415699] Other proteins in same PDB: d6bjqa1, d6bjqa2, d6bjqa4 automated match to d6u7ia3 complexed with bdp |
PDB Entry: 6bjq (more details), 2.7 Å
SCOPe Domain Sequences for d6bjqa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bjqa3 c.1.8.0 (A:287-610) automated matches {Eubacterium eligens [TaxId: 515620]} vrvdgtkflinekpfyfkgygkhedtfpngrginlpmntkdisimkwqhansfrtshypy seemmrlcdeegivvidettavgvnlqfggganfggerigtfdkehgvqtqehhkdvird lisrdknhacvvmwsianepdsaaegaydyfkplydlareldpqkrpctlvsvqgttadt dcssqlsdviclnryygwyfggpdlevseiglrkelsdwgklgkpvmfteygadtvsglh dttsvmyteeyqveyyemnnkvfdefdfvvgeqawnfadfatsqsllrvqgnkkglftrd rkpkmvahyfrnrwstipefgykt
Timeline for d6bjqa3: