Lineage for d6bjqa3 (6bjq A:287-610)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832699Species Eubacterium eligens [TaxId:515620] [420003] (3 PDB entries)
  8. 2832700Domain d6bjqa3: 6bjq A:287-610 [415699]
    Other proteins in same PDB: d6bjqa1, d6bjqa2, d6bjqa4
    automated match to d6u7ia3
    complexed with bdp

Details for d6bjqa3

PDB Entry: 6bjq (more details), 2.7 Å

PDB Description: eubacterium eligens beta-glucuronidase bound to glucuronic acid
PDB Compounds: (A:) Glycoside Hydrolase Family 2 candidate b-glucuronidase

SCOPe Domain Sequences for d6bjqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bjqa3 c.1.8.0 (A:287-610) automated matches {Eubacterium eligens [TaxId: 515620]}
vrvdgtkflinekpfyfkgygkhedtfpngrginlpmntkdisimkwqhansfrtshypy
seemmrlcdeegivvidettavgvnlqfggganfggerigtfdkehgvqtqehhkdvird
lisrdknhacvvmwsianepdsaaegaydyfkplydlareldpqkrpctlvsvqgttadt
dcssqlsdviclnryygwyfggpdlevseiglrkelsdwgklgkpvmfteygadtvsglh
dttsvmyteeyqveyyemnnkvfdefdfvvgeqawnfadfatsqsllrvqgnkkglftrd
rkpkmvahyfrnrwstipefgykt

SCOPe Domain Coordinates for d6bjqa3:

Click to download the PDB-style file with coordinates for d6bjqa3.
(The format of our PDB-style files is described here.)

Timeline for d6bjqa3:

  • d6bjqa3 is new in SCOPe 2.08-stable