SCOP 1.73: Domain d1cqie2: 1cqi E:1-238

Lineage for d1cqie2 (1cqi E:1-238)

Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Consists of two subdomains with different alpha+beta folds
shares functional and structural similarities with the PIPK and protein kinase superfamilies
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families)
Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
Species Escherichia coli [TaxId:562] [56083] (6 PDB entries)
Domain d1cqie2: 1cqi E:1-238 [41569]
Other proteins in same PDB: d1cqia1, d1cqia2, d1cqib1, d1cqid1, d1cqid2, d1cqie1

Details for d1cqie2

PDB Entry: 1cqi (more details), 3.3 Å

PDB Description: crystal structure of the complex of adp and mg2+ with dephosphorylated e. coli succinyl-coa synthetase

PDB Compounds: (E:) protein (succinyl-coa synthetase beta chain)

SCOP Domain Sequences for d1cqie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqie2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOP Domain Coordinates for d1cqie2:

Click to download the PDB-style file with coordinates for d1cqie2.
(The format of our PDB-style files is described here.)

Timeline for d1cqie2: