SCOPe 2.06: Domain d1scue2: 1scu E:1-238

Lineage for d1scue2 (1scu E:1-238)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
   automatically mapped to Pfam PF13549
   automatically mapped to Pfam PF08442

6. Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)

7. Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)

8. Domain d1scue2: 1scu E:1-238 [41567]
   Other proteins in same PDB: d1scua1, d1scua2, d1scub1, d1scud1, d1scud2, d1scue1
   complexed with coa

Details for d1scue2

PDB Entry: 1scu, 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution

PDB Compounds: (E:) succinyl-coa synthetase, beta subunit

SCOPe Domain Sequences for d1scue2:

Sequence; same for both SEQRES and ATOM records:

>d1scue2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

Timeline for d1scue2:

• d1scue2 first appeared (with stable ids) in SCOP 1.55
  
• d1scue2 appears in SCOPe 2.05
  
• d1scue2 appears in SCOPe 2.07
  
• d1scue2 appears in the current release, SCOPe 2.08