Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) |
Family d.41.2.0: automated matches [227168] (1 protein) not a true family |
Protein automated matches [226878] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [419805] (63 PDB entries) |
Domain d6b75b1: 6b75 B:9-163 [415667] Other proteins in same PDB: d6b75a2, d6b75b2, d6b75c2, d6b75d2 automated match to d2h3ba1 complexed with cvp |
PDB Entry: 6b75 (more details), 2.53 Å
SCOPe Domain Sequences for d6b75b1:
Sequence, based on SEQRES records: (download)
>d6b75b1 d.41.2.0 (B:9-163) automated matches {Human (Homo sapiens) [TaxId: 9606]} fnillatdsykvthykqyppntskvysyfecrekktensklrkvkyeetvfyglqyilnk ylkgkvvtkekiqeakdvykehfqddvfnekgwnyilekydghlpieikavpegfviprg nvlftventdpecywltnwietilvqswypitvat
>d6b75b1 d.41.2.0 (B:9-163) automated matches {Human (Homo sapiens) [TaxId: 9606]} fnillatdsykvthykqyppntskvysyfecrekvkyeetvfyglqyilnkylkgkvvtk ekiqeakdvykehfqddvfnekgwnyilekydghlpieikavpegfviprgnvlftvent dpecywltnwietilvqswypitvat
Timeline for d6b75b1: