![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) ![]() |
![]() | Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein) |
![]() | Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [56083] (4 PDB entries) |
![]() | Domain d2scue2: 2scu E:1-238 [41563] Other proteins in same PDB: d2scua1, d2scua2, d2scub1, d2scud1, d2scud2, d2scue1 |
PDB Entry: 2scu (more details), 2.3 Å
SCOP Domain Sequences for d2scue2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2scue2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli} mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe
Timeline for d2scue2: