Lineage for d1auxa2 (1aux A:214-417)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36099Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 36100Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 36200Family d.142.1.3: Synapsin Ia, C-terminal domain [56078] (1 protein)
  6. 36201Protein Synapsin Ia, C-terminal domain [56079] (1 species)
  7. 36202Species Cow (Bos taurus) [TaxId:9913] [56080] (2 PDB entries)
  8. 36205Domain d1auxa2: 1aux A:214-417 [41560]
    Other proteins in same PDB: d1auxa1, d1auxb1

Details for d1auxa2

PDB Entry: 1aux (more details), 2.3 Å

PDB Description: structure of the c domain of synapsin ia from bovine brain with calcium atp-gamma-s bound

SCOP Domain Sequences for d1auxa2:

Sequence, based on SEQRES records: (download)

>d1auxa2 d.142.1.3 (A:214-417) Synapsin Ia, C-terminal domain {Cow (Bos taurus)}
nslhsvynfcdkpwvfaqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyattepfidakydvriqkigqnykaymrtsvsg
nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp
ligdhqdedkqlivelvvnkmaqa

Sequence, based on observed residues (ATOM records): (download)

>d1auxa2 d.142.1.3 (A:214-417) Synapsin Ia, C-terminal domain {Cow (Bos taurus)}
nslhsvynfcdkpwvfaqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyattepfidakydvriqkigqnykaymrtleqi
amsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqliv
elvvnkmaqa

SCOP Domain Coordinates for d1auxa2:

Click to download the PDB-style file with coordinates for d1auxa2.
(The format of our PDB-style files is described here.)

Timeline for d1auxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1auxa1