SCOPe 2.08: Domain d5ytna1: 5ytn A:18-166

Lineage for d5ytna1 (5ytn A:18-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Geobacillus thermodenitrificans [TaxId:33940] [419991] (4 PDB entries)

8. Domain d5ytna1: 5ytn A:18-166 [415596]
   automated match to d6thea1
   complexed with cu, mrd, peo; mutant

Details for d5ytna1

PDB Entry: 5ytn, 1.75 Å

PDB Description: c135a mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans in complex with peroxide

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5ytna1:

Sequence; same for both SEQRES and ATOM records:

>d5ytna1 b.6.1.0 (A:18-166) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
iaahkgvnqapvplkmervgphdvhiemtaqitdieidkgkiykawtfngqapgplvvvn
egdtihftlknmdpvvphsmdfhavhaspskdfidvmpnksgtftypankpgvfmyhagt
kpvlqhiangmhgviivkpkngyptdkev

Timeline for d5ytna1:

• d5ytna1 is new in SCOPe 2.08-stable