![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.3: Synapsin C-terminal domain [56078] (3 proteins) automatically mapped to Pfam PF02750 |
![]() | Protein Synapsin [56079] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56080] (2 PDB entries) |
![]() | Domain d1auva2: 1auv A:214-417 [41558] Other proteins in same PDB: d1auva1, d1auvb1 |
PDB Entry: 1auv (more details), 2.15 Å
SCOPe Domain Sequences for d1auva2:
Sequence, based on SEQRES records: (download)
>d1auva2 d.142.1.3 (A:214-417) Synapsin {Cow (Bos taurus) [TaxId: 9913]} nslhsvynfcdkpwvfaqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmgha hsgmgkvkvdnqhdfqdiasvvaltktyattepfidakydvriqkigqnykaymrtsvsg nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp ligdhqdedkqlivelvvnkmaqa
>d1auva2 d.142.1.3 (A:214-417) Synapsin {Cow (Bos taurus) [TaxId: 9913]} nslhsvynfcdkpwvfaqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmgha hsgmgkvkvdnqhdfqdiasvvaltktyattepfidakydvriqkigqnykaymrtleqi amsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqliv elvvnkmaqa
Timeline for d1auva2: