Lineage for d1jdbk6 (1jdb K:677-935)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511685Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 511686Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) (S)
  5. 511706Family d.142.1.2: BC ATP-binding domain-like [56067] (5 proteins)
  6. 511717Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 511718Species Escherichia coli [TaxId:562] [56077] (10 PDB entries)
  8. 511750Domain d1jdbk6: 1jdb K:677-935 [41557]
    Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb3, d1jdbb4, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh3, d1jdbh4, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbl1, d1jdbl2

Details for d1jdbk6

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli

SCOP Domain Sequences for d1jdbk6:

Sequence, based on SEQRES records: (download)

>d1jdbk6 d.142.1.2 (K:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli}
fqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvlggrameivydeadlrry
fqtavsvsndapvlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacslp
aytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvskat
gvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstgev
mgvgrtfaeafakaqlgsn

Sequence, based on observed residues (ATOM records): (download)

>d1jdbk6 d.142.1.2 (K:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli}
fqhaverlklkqpanatvtaiemavekakeigyplvvrpameivydeadlrryfqtaapv
lldhflddavevdvdaicdgemvliggimehieqagvhsgdsacslpaytlsqeiqdvmr
qqvqklafelqvrglmnvqfavknnevylievnpraartvpfvskatgvplakvaarvma
gkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstgevmgvgrtfaeafak
aqlgsn

SCOP Domain Coordinates for d1jdbk6:

Click to download the PDB-style file with coordinates for d1jdbk6.
(The format of our PDB-style files is described here.)

Timeline for d1jdbk6: