Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Serratia sp. [TaxId:1327989] [328865] (5 PDB entries) |
Domain d5x1ra1: 5x1r A:11-293 [415545] Other proteins in same PDB: d5x1ra2 automated match to d5tosa_ |
PDB Entry: 5x1r (more details), 1.6 Å
SCOPe Domain Sequences for d5x1ra1:
Sequence, based on SEQRES records: (download)
>d5x1ra1 d.144.1.0 (A:11-293) automated matches {Serratia sp. [TaxId: 1327989]} snslpsgyrfnefeiqeaigeggfgivyraydhqlertiaikeymptslakrnddlsigl rgerfgktfqaglnsfiqearllarfshpgllhvlrfweengtaymgtqfysgttlknlq aqqpekideawirrllpplfsaintihqegylhrdisldniqiqesqlpvlldfgsarke ignlsdeteivlkpgfapieqytensdgeqgpwtdiyalgavlhtlivgspppvsvvrsi edsyqplterrpagyspellrtvdralalkpedrpqtidemae
>d5x1ra1 d.144.1.0 (A:11-293) automated matches {Serratia sp. [TaxId: 1327989]} snslpsgyrfnefeiqeaigeggfgivyraydhqlertiaikeymptslakrnddlsigl rgerfgktfqaglnsfiqearllarfshpgllhvlrfweengtaymgtqfysgttlknlq aqqpekideawirrllpplfsaintihqegylhrdisldniqiqesqlpvlldfgsarke ignlsdeteivlkpgfapieqyteqgpwtdiyalgavlhtlivgspppvsvvrsiedsyq plterrpagyspellrtvdralalkpedrpqtidemae
Timeline for d5x1ra1: