Lineage for d1jdbh5 (1jdb H:128-402)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137856Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 137857Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 137877Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 137886Protein Carbamoyl phosphate synthetase (CPS), large subunit [56076] (1 species)
  7. 137887Species Escherichia coli [TaxId:562] [56077] (8 PDB entries)
  8. 137916Domain d1jdbh5: 1jdb H:128-402 [41554]
    Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb3, d1jdbb4, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh3, d1jdbh4, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbl1, d1jdbl2

Details for d1jdbh5

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli
PDB Compounds: (H:)

SCOP Domain Sequences for d1jdbh5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbh5 d.142.1.2 (H:128-402) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
rrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynreef
eeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgdsi
tvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrss
alaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekfa
gandrlttqmksvgevmaigrtqqeslqkalrgle

SCOP Domain Coordinates for d1jdbh5:

Click to download the PDB-style file with coordinates for d1jdbh5.
(The format of our PDB-style files is described here.)

Timeline for d1jdbh5: