Lineage for d5w3ga1 (5w3g A:167-272)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693426Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2693472Protein automated matches [191121] (2 species)
    not a true protein
  7. 2693498Species Mouse (Mus musculus) [TaxId:10090] [189188] (2 PDB entries)
  8. 2693500Domain d5w3ga1: 5w3g A:167-272 [415527]
    Other proteins in same PDB: d5w3ga2
    automated match to d1puef_

Details for d5w3ga1

PDB Entry: 5w3g (more details)

PDB Description: solution structure of ets transcription factor pu.1
PDB Compounds: (A:) Transcription factor PU.1

SCOPe Domain Sequences for d5w3ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w3ga1 a.4.5.21 (A:167-272) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gskkkirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmt
yqkmaralrnygktgevkkvkkkltyqfsgevlgrgglaerrlpph

SCOPe Domain Coordinates for d5w3ga1:

Click to download the PDB-style file with coordinates for d5w3ga1.
(The format of our PDB-style files is described here.)

Timeline for d5w3ga1:

  • d5w3ga1 is new in SCOPe 2.08-stable

2693500
d5w3ga1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5w3ga2