Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [419980] (1 PDB entry) |
Domain d5ui3d_: 5ui3 D: [415503] automated match to d7lvla_ complexed with akg |
PDB Entry: 5ui3 (more details), 2 Å
SCOPe Domain Sequences for d5ui3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ui3d_ c.1.10.0 (D:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} stvdrlkklrlitaiktpylangkfdlpaydalvshqiengveglivggttgeghlmswd ehvmliahtvnafgdktavigntgsnstrealhateqgfavgmhaslqinpyygktskag llnhfnavlnegpavvynvpgrtgqdipddvvmeicqhsnflgmkectgnsriknytskg vncwsgnddeshdarhsngavgvisvtsnvipglmhklmhgspdpqlnadlkelmawmfc epnpislntalamcglarpvfrlpyvplsraqrekgavllnkvqehipgcksvrvmedhe filvg
Timeline for d5ui3d_: