Lineage for d5ui3d_ (5ui3 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836345Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [419980] (1 PDB entry)
  8. 2836348Domain d5ui3d_: 5ui3 D: [415503]
    automated match to d7lvla_
    complexed with akg

Details for d5ui3d_

PDB Entry: 5ui3 (more details), 2 Å

PDB Description: crystal structure of dhdps from chlamydomonas reinhardtii
PDB Compounds: (D:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d5ui3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ui3d_ c.1.10.0 (D:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
stvdrlkklrlitaiktpylangkfdlpaydalvshqiengveglivggttgeghlmswd
ehvmliahtvnafgdktavigntgsnstrealhateqgfavgmhaslqinpyygktskag
llnhfnavlnegpavvynvpgrtgqdipddvvmeicqhsnflgmkectgnsriknytskg
vncwsgnddeshdarhsngavgvisvtsnvipglmhklmhgspdpqlnadlkelmawmfc
epnpislntalamcglarpvfrlpyvplsraqrekgavllnkvqehipgcksvrvmedhe
filvg

SCOPe Domain Coordinates for d5ui3d_:

Click to download the PDB-style file with coordinates for d5ui3d_.
(The format of our PDB-style files is described here.)

Timeline for d5ui3d_:

  • d5ui3d_ is new in SCOPe 2.08-stable