![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
![]() | Protein automated matches [190858] (25 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:487214] [419979] (2 PDB entries) |
![]() | Domain d5u8mb2: 5u8m B:128-229 [415499] Other proteins in same PDB: d5u8ma1, d5u8ma3, d5u8mb1, d5u8mb3 automated match to d5vfab2 |
PDB Entry: 5u8m (more details), 2.11 Å
SCOPe Domain Sequences for d5u8mb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u8mb2 a.4.6.0 (B:128-229) automated matches {Streptococcus pneumoniae [TaxId: 487214]} cslmkvprtyrnlridvehhtvyrgeemialtrreydllatlmgskkvltreqllesvwk yesatetnivdvyirylrskldvkgqksyiktvrgvgytmqe
Timeline for d5u8mb2: