SCOPe 2.08: Domain d5u8mb2: 5u8m B:128-229

Lineage for d5u8mb2 (5u8m B:128-229)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:487214] [419979] (2 PDB entries)

8. Domain d5u8mb2: 5u8m B:128-229 [415499]
   Other proteins in same PDB: d5u8ma1, d5u8ma3, d5u8mb1, d5u8mb3
   automated match to d5vfab2

Details for d5u8mb2

PDB Entry: 5u8m, 2.11 Å

PDB Description: a novel family of redox sensors in the streptococci evolved from two- component response regulators

PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d5u8mb2:

Sequence; same for both SEQRES and ATOM records:

>d5u8mb2 a.4.6.0 (B:128-229) automated matches {Streptococcus pneumoniae [TaxId: 487214]}
cslmkvprtyrnlridvehhtvyrgeemialtrreydllatlmgskkvltreqllesvwk
yesatetnivdvyirylrskldvkgqksyiktvrgvgytmqe

Timeline for d5u8mb2:

• d5u8mb2 is new in SCOPe 2.08-stable