![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
![]() | Protein automated matches [190131] (86 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:487214] [419978] (2 PDB entries) |
![]() | Domain d5u8mb1: 5u8m B:2-127 [415498] Other proteins in same PDB: d5u8ma2, d5u8ma3, d5u8mb2, d5u8mb3 automated match to d5vfab1 |
PDB Entry: 5u8m (more details), 2.11 Å
SCOPe Domain Sequences for d5u8mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u8mb1 c.23.1.0 (B:2-127) automated matches {Streptococcus pneumoniae [TaxId: 487214]} gkrilllekernlahflslelqkeqyrvdlveegqkalsmalqtdydlillnvnlgdmma qdfaeklsrtkpasvimildhwedlqeelevvqrfavsyiykpvlienlvarisaifrgr dfidqh
Timeline for d5u8mb1: