Lineage for d5u8ma2 (5u8m A:128-229)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695410Species Streptococcus pneumoniae [TaxId:171101] [350919] (3 PDB entries)
  8. 2695414Domain d5u8ma2: 5u8m A:128-229 [415496]
    Other proteins in same PDB: d5u8ma1, d5u8ma3, d5u8mb1, d5u8mb3
    automated match to d5vfab2

Details for d5u8ma2

PDB Entry: 5u8m (more details), 2.11 Å

PDB Description: a novel family of redox sensors in the streptococci evolved from two- component response regulators
PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d5u8ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u8ma2 a.4.6.0 (A:128-229) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
cslmkvprtyrnlridvehhtvyrgeemialtrreydllatlmgskkvltreqllesvwk
yesatetnivdvyirylrskldvkgqksyiktvrgvgytmqe

SCOPe Domain Coordinates for d5u8ma2:

Click to download the PDB-style file with coordinates for d5u8ma2.
(The format of our PDB-style files is described here.)

Timeline for d5u8ma2:

  • d5u8ma2 is new in SCOPe 2.08-stable