Lineage for d5u8ma1 (5u8m A:2-127)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856124Species Streptococcus pneumoniae [TaxId:171101] [226388] (5 PDB entries)
  8. 2856132Domain d5u8ma1: 5u8m A:2-127 [415495]
    Other proteins in same PDB: d5u8ma2, d5u8ma3, d5u8mb2, d5u8mb3
    automated match to d5vfab1

Details for d5u8ma1

PDB Entry: 5u8m (more details), 2.11 Å

PDB Description: a novel family of redox sensors in the streptococci evolved from two- component response regulators
PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d5u8ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u8ma1 c.23.1.0 (A:2-127) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
gkrilllekernlahflslelqkeqyrvdlveegqkalsmalqtdydlillnvnlgdmma
qdfaeklsrtkpasvimildhwedlqeelevvqrfavsyiykpvlienlvarisaifrgr
dfidqh

SCOPe Domain Coordinates for d5u8ma1:

Click to download the PDB-style file with coordinates for d5u8ma1.
(The format of our PDB-style files is described here.)

Timeline for d5u8ma1:

  • d5u8ma1 is new in SCOPe 2.08-stable