Lineage for d1bxre6 (1bxr E:677-935)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84221Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 84222Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 84242Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 84251Protein Carbamoyl phosphate synthetase (CPS), large subunit [56076] (1 species)
  7. 84252Species Escherichia coli [TaxId:562] [56077] (7 PDB entries)
  8. 84298Domain d1bxre6: 1bxr E:677-935 [41547]
    Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrd1, d1bxrd2, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrh1, d1bxrh2

Details for d1bxre6

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

SCOP Domain Sequences for d1bxre6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxre6 d.142.1.2 (E:677-935) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvlggrameivydeadlrr
yfqtavsvsndapvlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacsl
paytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvska
tgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstge
vmgvgrtfaeafakaqlgs

SCOP Domain Coordinates for d1bxre6:

Click to download the PDB-style file with coordinates for d1bxre6.
(The format of our PDB-style files is described here.)

Timeline for d1bxre6: