Lineage for d5szrc3 (5szr C:415-524)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763525Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2763526Protein automated matches [190458] (4 species)
    not a true protein
  7. 2763600Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries)
  8. 2763629Domain d5szrc3: 5szr C:415-524 [415462]
    automated match to d5tfka2
    complexed with ca, edo, man

Details for d5szrc3

PDB Entry: 5szr (more details), 2.3 Å

PDB Description: protocadherin gamma b2 extracellular cadherin domains 3-6
PDB Compounds: (C:) Protein Pcdhgb2

SCOPe Domain Sequences for d5szrc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5szrc3 b.1.6.0 (C:415-524) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vndnapvfhqasylvhvaennppgtsiaqvsasdpdlgsnglisysiiasdlepralssf
vsvnqdsgvvfaqrafdheqlrsfqltlqardhgsptlsanvsmrvlvgd

SCOPe Domain Coordinates for d5szrc3:

Click to download the PDB-style file with coordinates for d5szrc3.
(The format of our PDB-style files is described here.)

Timeline for d5szrc3:

  • d5szrc3 is new in SCOPe 2.08-stable