Lineage for d1ce8e5 (1ce8 E:128-402)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84221Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 84222Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 84242Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 84251Protein Carbamoyl phosphate synthetase (CPS), large subunit [56076] (1 species)
  7. 84252Species Escherichia coli [TaxId:562] [56077] (7 PDB entries)
  8. 84289Domain d1ce8e5: 1ce8 E:128-402 [41538]
    Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8d1, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e3, d1ce8e4, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8h1, d1ce8h2

Details for d1ce8e5

PDB Entry: 1ce8 (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp

SCOP Domain Sequences for d1ce8e5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce8e5 d.142.1.2 (E:128-402) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
drrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynree
feeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgds
itvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrs
salaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekf
agandrlttqmksvgevmaigrtqqeslqkalrgl

SCOP Domain Coordinates for d1ce8e5:

Click to download the PDB-style file with coordinates for d1ce8e5.
(The format of our PDB-style files is described here.)

Timeline for d1ce8e5: