Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) |
Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins) |
Protein Carbamoyl phosphate synthetase (CPS), large subunit [56076] (1 species) |
Species Escherichia coli [TaxId:562] [56077] (7 PDB entries) |
Domain d1ce8e5: 1ce8 E:128-402 [41538] Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8d1, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e3, d1ce8e4, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8h1, d1ce8h2 |
PDB Entry: 1ce8 (more details), 2.1 Å
SCOP Domain Sequences for d1ce8e5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ce8e5 d.142.1.2 (E:128-402) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli} drrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynree feeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgds itvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrs salaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekf agandrlttqmksvgevmaigrtqqeslqkalrgl
Timeline for d1ce8e5:
View in 3D Domains from other chains: (mouse over for more information) d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8d2, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h1, d1ce8h2 |