Lineage for d1c3oe6 (1c3o E:677-935)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734347Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 734348Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families) (S)
  5. 734368Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)
  6. 734391Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 734392Species Escherichia coli [TaxId:562] [56077] (10 PDB entries)
  8. 734446Domain d1c3oe6: 1c3o E:677-935 [41531]
    Other proteins in same PDB: d1c3oa1, d1c3oa2, d1c3oa3, d1c3oa4, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc3, d1c3oc4, d1c3od1, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe3, d1c3oe4, d1c3of1, d1c3of2, d1c3og1, d1c3og2, d1c3og3, d1c3og4, d1c3oh1, d1c3oh2

Details for d1c3oe6

PDB Entry: 1c3o (more details), 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine
PDB Compounds: (E:) carbamoyl phosphate synthetase: large subunit

SCOP Domain Sequences for d1c3oe6:

Sequence, based on SEQRES records: (download)

>d1c3oe6 d.142.1.2 (E:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvlggrameivydeadlrr
yfqtavsvsndapvlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacsl
paytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvska
tgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstge
vmgvgrtfaeafakaqlgs

Sequence, based on observed residues (ATOM records): (download)

>d1c3oe6 d.142.1.2 (E:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpameivydeadlrryfqtavl
ldhflddavevdvdaicdgemvliggimehieqagvhsgdsacslpaytlsqeiqdvmrq
qvqklafelqvrglmnvqfavknnevylievnpraartvpfvskatgvplakvaarvmag
kslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstgevmgvgrtfaeafaka
qlgs

SCOP Domain Coordinates for d1c3oe6:

Click to download the PDB-style file with coordinates for d1c3oe6.
(The format of our PDB-style files is described here.)

Timeline for d1c3oe6: