Lineage for d5q5oa_ (5q5o A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997289Family d.157.1.15: DNA repair metallo-beta-lactamase-like [418785] (1 protein)
    Pfam PF07522
  6. 2997290Protein DNA cross-link repair 1A protein [419082] (1 species)
  7. 2997291Species Human (Homo sapiens) [TaxId:9606] [419578] (312 PDB entries)
  8. 2997591Domain d5q5oa_: 5q5o A: [415288]
    automated match to d4b87a_
    complexed with mli, ni

Details for d5q5oa_

PDB Entry: 5q5o (more details), 2.07 Å

PDB Description: pandda analysis group deposition -- crystal structure of dclre1a after initial refinement with no ligand modelled (structure 125)
PDB Compounds: (A:) dclre1a

SCOPe Domain Sequences for d5q5oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5q5oa_ d.157.1.15 (A:) DNA cross-link repair 1A protein {Human (Homo sapiens) [TaxId: 9606]}
tcpfykkipgtgftvdafqygvvegctayflthfhsdhyaglskhftfpvycseitgnll
knklhvqeqyihplpldtecivngvkvvlldanhcpgavmilfylpngtvilhtgdfrad
psmerslladqkvhmlyldttycspeytfpsqqevirfaintafeavtlnphalvvcgty
sigkekvflaiadvlgskvgmsqekyktlqclnipeinslittdmcsslvhllpmmqinf
kglqshlkkcggkynqilafrptgwthsnkftriadvipqtkgnisiygipysehssyle
mkrfvqwlkpqkiiptvnvgtwksrstmekyfrewkleagy

SCOPe Domain Coordinates for d5q5oa_:

Click to download the PDB-style file with coordinates for d5q5oa_.
(The format of our PDB-style files is described here.)

Timeline for d5q5oa_:

  • d5q5oa_ is new in SCOPe 2.08-stable