Lineage for d1cs0g6 (1cs0 G:677-935)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928459Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 1928520Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 1928521Species Escherichia coli [TaxId:562] [56077] (10 PDB entries)
    Uniprot P00968
  8. 1928545Domain d1cs0g6: 1cs0 G:677-935 [41525]
    Other proteins in same PDB: d1cs0a1, d1cs0a2, d1cs0a3, d1cs0a4, d1cs0b1, d1cs0b2, d1cs0c1, d1cs0c2, d1cs0c3, d1cs0c4, d1cs0d1, d1cs0d2, d1cs0e1, d1cs0e2, d1cs0e3, d1cs0e4, d1cs0f1, d1cs0f2, d1cs0g1, d1cs0g2, d1cs0g3, d1cs0g4, d1cs0h1, d1cs0h2
    complexed with adp, cl, k, mn, net, orn, po4

Details for d1cs0g6

PDB Entry: 1cs0 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde
PDB Compounds: (G:) carbamoyl phosphate synthetase: large subunit

SCOPe Domain Sequences for d1cs0g6:

Sequence, based on SEQRES records: (download)

>d1cs0g6 d.142.1.2 (G:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvlggrameivydeadlrr
yfqtavsvsndapvlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacsl
paytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvska
tgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstge
vmgvgrtfaeafakaqlgs

Sequence, based on observed residues (ATOM records): (download)

>d1cs0g6 d.142.1.2 (G:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpameivydeadlrryfqtavl
ldhflddavevdvdaicdgemvliggimehieqagvhsgdsacslpaytlsqeiqdvmrq
qvqklafelqvrglmnvqfavknnevylievnpraartvpfvskatgvplakvaarvmag
kslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstgevmgvgrtfaeafaka
qlgs

SCOPe Domain Coordinates for d1cs0g6:

Click to download the PDB-style file with coordinates for d1cs0g6.
(The format of our PDB-style files is described here.)

Timeline for d1cs0g6: