Lineage for d1cs0e5 (1cs0 E:128-402)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36099Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 36100Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 36117Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 36126Protein Carbamoyl phosphate synthetase (CPS), large subunit [56076] (1 species)
  7. 36127Species Escherichia coli [TaxId:562] [56077] (7 PDB entries)
  8. 36148Domain d1cs0e5: 1cs0 E:128-402 [41522]
    Other proteins in same PDB: d1cs0a1, d1cs0a2, d1cs0a3, d1cs0a4, d1cs0b1, d1cs0b2, d1cs0c1, d1cs0c2, d1cs0c3, d1cs0c4, d1cs0d1, d1cs0d2, d1cs0e1, d1cs0e2, d1cs0e3, d1cs0e4, d1cs0f1, d1cs0f2, d1cs0g1, d1cs0g2, d1cs0g3, d1cs0g4, d1cs0h1, d1cs0h2

Details for d1cs0e5

PDB Entry: 1cs0 (more details), 2 Å

PDB Description: Crystal structure of carbamoyl phosphate synthetase complexed at CYS269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde

SCOP Domain Sequences for d1cs0e5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs0e5 d.142.1.2 (E:128-402) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
drrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynree
feeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgds
itvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrs
salaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekf
agandrlttqmksvgevmaigrtqqeslqkalrgl

SCOP Domain Coordinates for d1cs0e5:

Click to download the PDB-style file with coordinates for d1cs0e5.
(The format of our PDB-style files is described here.)

Timeline for d1cs0e5: