Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.15: DNA repair metallo-beta-lactamase-like [418785] (1 protein) Pfam PF07522 |
Protein DNA cross-link repair 1A protein [419082] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [419578] (312 PDB entries) |
Domain d5q1xa_: 5q1x A: [415154] automated match to d4b87a_ complexed with ay4, mli, ni |
PDB Entry: 5q1x (more details), 1.42 Å
SCOPe Domain Sequences for d5q1xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5q1xa_ d.157.1.15 (A:) DNA cross-link repair 1A protein {Human (Homo sapiens) [TaxId: 9606]} tcpfykkipgtgftvdafqygvvegctayflthfhsdhyaglskhftfpvycseitgnll knklhvqeqyihplpldtecivngvkvvlldanhcpgavmilfylpngtvilhtgdfrad psmerslladqkvhmlyldttycspeytfpsqqevirfaintafeavtlnphalvvcgty sigkekvflaiadvlgskvgmsqekyktlqclnipeinslittdmcsslvhllpmmqinf kglqshlkkcggkynqilafrptgwthsnkftriadvipqtkgnisiygipysehssyle mkrfvqwlkpqkiiptvnvgtwksrstmekyfrewkleagy
Timeline for d5q1xa_: