Lineage for d1c30c5 (1c30 C:128-402)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36099Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 36100Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 36117Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 36126Protein Carbamoyl phosphate synthetase (CPS), large subunit [56076] (1 species)
  7. 36127Species Escherichia coli [TaxId:562] [56077] (7 PDB entries)
  8. 36138Domain d1c30c5: 1c30 C:128-402 [41512]
    Other proteins in same PDB: d1c30a1, d1c30a2, d1c30a3, d1c30a4, d1c30b1, d1c30b2, d1c30c1, d1c30c2, d1c30c3, d1c30c4, d1c30d1, d1c30d2, d1c30e1, d1c30e2, d1c30e3, d1c30e4, d1c30f1, d1c30f2, d1c30g1, d1c30g2, d1c30g3, d1c30g4, d1c30h1, d1c30h2

Details for d1c30c5

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

SCOP Domain Sequences for d1c30c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30c5 d.142.1.2 (C:128-402) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
drrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynree
feeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgds
itvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrs
salaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekf
agandrlttqmksvgevmaigrtqqeslqkalrgl

SCOP Domain Coordinates for d1c30c5:

Click to download the PDB-style file with coordinates for d1c30c5.
(The format of our PDB-style files is described here.)

Timeline for d1c30c5: