Lineage for d1a9xg6 (1a9x G:6677-6935)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511685Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 511686Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) (S)
  5. 511706Family d.142.1.2: BC ATP-binding domain-like [56067] (5 proteins)
  6. 511717Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 511718Species Escherichia coli [TaxId:562] [56077] (10 PDB entries)
  8. 511726Domain d1a9xg6: 1a9x G:6677-6935 [41509]
    Other proteins in same PDB: d1a9xa1, d1a9xa2, d1a9xa3, d1a9xa4, d1a9xb1, d1a9xb2, d1a9xc1, d1a9xc2, d1a9xc3, d1a9xc4, d1a9xd1, d1a9xd2, d1a9xe1, d1a9xe2, d1a9xe3, d1a9xe4, d1a9xf1, d1a9xf2, d1a9xg1, d1a9xg2, d1a9xg3, d1a9xg4, d1a9xh1, d1a9xh2

Details for d1a9xg6

PDB Entry: 1a9x (more details), 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis

SCOP Domain Sequences for d1a9xg6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9xg6 d.142.1.2 (G:6677-6935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli}
rfqhaverlklkqpanatvtaiemavekakeigyplvvraameivydeadlrryfqtavl
ldhflddavevdvdaicdgemvliggimehieqagvhsgdsacslpaytlsqeiqdvmrq
qvqklafelqvrglmnvqfavknnevylievnpraartvpfvskatgvplakvaarvmag
kslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstgevmgvgrtfaeafaka
qlgs

SCOP Domain Coordinates for d1a9xg6:

Click to download the PDB-style file with coordinates for d1a9xg6.
(The format of our PDB-style files is described here.)

Timeline for d1a9xg6: